SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194163 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194163
Domain Number 1 Region: 23-202
Classification Level Classification E-value
Superfamily vWA-like 0.000000001
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194163
Sequence length 229
Sequence
MDFSIKLVFLLILFEPTLQQSCDVFFIIDGSNVITDNARSGDRLQQWYSIRTIVADVLQN
LTNFNVAISIYADKVWQVATYPTPGPQASLIMKSLDFLGGQFAVGAAIKWTRENVITPNK
QTNANIACFLLATYPPFGNDLIVWNTEKNLLRGICGKLIVLAIGRIDLENVYKSIATSSD
SFLRIDFTNLSENKAIGSFMLNQILSACPSRPTSATFSTITTTTLRPAQ
Download sequence
Identical sequences T1FVR7
jgi|Helro1|194163 XP_009028697.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]