SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194250 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194250
Domain Number 1 Region: 14-143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000897
Family Clostridium neurotoxins, the second last domain 0.055
Further Details:      
 
Domain Number 2 Region: 233-383,416-591
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000115
Family Mo25 protein 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194250
Sequence length 1498
Sequence
MAMIVTTTAVAVMMFGSFRTSKGVGYSGHFFGNALVITSMKIKGKGFQHCVKYDFHPREW
YMITIVFVYNRWSKSELHCYVDGVPASHTDMTWLVNTSDPYDKCYLGCSHDMDPETIFSG
QLSSVYLFGEALSANQIAALEYLGPGYKGQFRFENESGLLLNEPVKRILYDGKLSQAIVF
LYTPVSCDSQLCLESSPKYNPTYFLHSPHALMQNQVRSVATHSIHSTLHSIGGVQVLYPL
FSQLDYPQQTQSDFVDYNICSILMRLLCDLIETSNTIQQQFLQTKGFLVISFLLEKSTRH
HITMNVLNCFLSMTKYLVSLPTGGPLLKHLLDHILFNPALWIYSNIAVQRKLYTYLSTDF
ISDAQIYNNIRRVSSVMQTMHSLLYYYWVVNPQNRSGVTPKGVDGPRPSREDILELRSFL
LQYIRHLVVRGSGVQDEELLSLINYLSTVHEDDNIMDVLDLTVQLMAEHPASMVPAFDRK
GGIKAVFKLLASSNELIRIQALKLLGFFLTRSTHKRKHEAMTPYNLFSLITERLSLNSQY
LTVGTYHVLFEIMTEKMTCDIVIERTEEPDNSYKLENPLILKVIASLIRQSQGHPNQVMA
VKRVVLQMSVWQDWLFSMAYIYPKDEEEQQITESVMSLFRMLLHHAVKFEFGGWRVWIDT
LAILHSKVSNEDFRIHMVRVYQQYDRMQVTNVADPNLRRRHPISTISGLGAIQNGGGGHV
GANNSSGNAITSGRGNDDDDDDNDVDEEEEDERNKEKVVLLASEAAVRSLVFIGARCTPV
EDVHILVTSCGGLLPLLAAATSPKGEIEMLEPNQGLSIEQAVSFLQRLINMADILVFASS
LNFSELEQEKSMNSGGILRQCLRLVCTAAVRNCLECRYRQQQQQLQQLQQQQQQQAMAIS
GSAATAVTAVSGGGGGVGSRKLSSSNNNSNADNERPDPIQALIAGVHPNKNTMDKLGSIN
PIRDPEKLLQEMDINRLRAVVYRDVEETKQAQFLALAIVYFVSVLMVSKYRDILEPAISN
SAGNGTGGSGGNNNNNNNNNGKKKREVNDGGGVVKDGYYKRNNSRNSKYIYNQYTTNDDD
DDNDDDAGNSNSYGGNSRCVNGGGGDVYGDDDVIIGADDDDDDDVDVTTSVLSQIYLSGW
GCEGESLKVVARIEHDPRNDVNNYVINNNNNSNNNNDDNGVNGDKNNNDVVVAGQSDKTA
TLANDNSNNNNNNQRLQLGTSTSDVTNITQHQQQHSTTTTATKSTTLPLAASTAATILSP
YGTGDNMHLSSQIDTSLISVTTMASSSILTEISDDVDDADVSTAAGVNTAATSAAAPTAA
APTTAANETATTPAVVTVDSDVVTAVASRGGEAAVMPHVGDLEPHHHHHFQQQQNPKSAI
YRRSTSEAPNNPDDDNNGGDGDDDDDGDDGDDGDYGDGGGNSSDRVVVSHANIPGPVQVI
GAQQMLLSDNKDSGTLTERLERALGPVAPLLREIFVDFASFLSKTLLGSHGQELLIGG
Download sequence
Identical sequences T1FVV0
XP_009029509.1.102002 jgi|Helro1|194250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]