SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194269 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194269
Domain Number 1 Region: 1859-2052
Classification Level Classification E-value
Superfamily vWA-like 8.21e-24
Family Integrin A (or I) domain 0.0029
Further Details:      
 
Domain Number 2 Region: 2417-2524
Classification Level Classification E-value
Superfamily TNF-like 0.00000000995
Family TNF-like 0.0059
Further Details:      
 
Domain Number 3 Region: 2128-2257
Classification Level Classification E-value
Superfamily TNF-like 0.0000124
Family TNF-like 0.0041
Further Details:      
 
Domain Number 4 Region: 2304-2388
Classification Level Classification E-value
Superfamily TNF-like 0.0000639
Family TNF-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194269
Sequence length 2524
Sequence
MDFDISSRPPCWVQTGGTFDFNNVVPNQPNVTNLRLETCTTASTSVRTILPAKSSLCWKS
YQQTRYIGLQQISLNTITECQNYCFNEVACYVMDFDISSRPPCWVQTGGTFDFNNVVPNQ
PNVTNLRLETCTTASTTFPAKAGLCWKTYPQTLYVGLTQTNYASIKECQDYCYSFSACYL
FNYDTSTQPPCWVQTTGSFNASNVLSGFPSLTNFRLETCTSSSTKKTSLPCVRVYFDKSS
PGASSVATGLTALQCLTSCVTTSTNCAAVDFDVTTDCSFQFLNNTSSYGGRQANQINTLQ
ECLRYCINTPSCLALDFNVQNECWIHTDLSIVVTNRIANSQVTQFVLNRVNCISQPSQTT
SASRTASTTSISTACLLATFQNTNSYGGMLVDSINNSVSCLNYCLITISCVGADFNTASN
QCFQHTDKNAFENTKNVNSPGIIQFVKNPNCGLSTSPVIDCLIATYQNTNSQGGAQVFGI
FSSPICLSFCLSRPTCVGVDFDVVLGQCFIHSNKYQFETTRQMNSAQGVIQYVMSTNCTG
VTTQSTTRPVTMFTSRQPLSCAPSFRIYFNSSSSTSATQQSQLDALQCMVSCFISSRTCV
AVDFSPVRTCYSYNDRGQVESARRTLNFVNQYIVDRSCNLPLPYCSYQFFMSTSSVGAQQ
ATQATDLQSCLYLCIATPTCVAVDFNAQNQCWWHSSTSAVTNNRMTNTDVSQFVLNRVNC
DVLPPIIFTSSSSSAPVSISTSAPLSCAPSFRVYFNATSLGSNDLLPQLDAVQCITNCFI
SSTTCAAVDFKIGSGCWRFTDRNQVDATRTTNNLVTQFVAERSCALPLPFCSYQFFGGTS
SYGAQLAQQINTLQDCLYLCITTTNCVAVDYNVQNQCWLHDNLTVVLQNRGINTESSQLV
LNRVNCYVGPPIVQTSTQSGIVTQPQPCQPSFRIFFNSTSSGSTDFLPQLNTTIQCITNC
FITSAACAAVDFRTDNLGCSRFTNRFQVDATRTANNFVTQFVAERSCALPFSFCSYQFYS
GTSSYGAQLAQQINSLQDCLYLCIVTLNCVALDYNVQNQCWWHSDRNVVTNNRGANPESS
QFVLNRVNCVVPLSSAQTTTESQVVTQPQPCAPSFRVYFNATSPGSNDLLPQLDAVQCIT
NCFISSTACAAVDFRIGSGCWRFTDRNQVDATRTTNNLVTQFVAERSCALPLPFCSYQFY
SGTSSYGAQLAQQINSLQDCLYLCIVTLNCVALDYNVQNQCWWHSDRNAVTNNRGANPES
SQFVLNRVNCLVTPPILSTTTQRGVSTQSQTCPPSFRVYFNSTTFGSVSQQPQYNALQCI
TNCFIASTTCVAAEYSDAICSFQFNFNVSSYGAQLANQISSLQDCLYLCINTPNCVAVDY
NILNQCWIHNNINVVLSNQDTNPDASQFILNRVNCATVSVGTTLSPATTPSVLRTSTRPY
TINPNFTCVDWVKLVQTRAANHIYQSQFRDLNSCLNGCYLVSRCVAVDVGASNSDCYFIY
DVNDDNYDLSFTQYQIQRQCYQKGPIPGQCQNYQQNVNQNSVNGRLYFQYTTVPACKDLC
FSIPTCVAFDFNTNTADPNFGCWLHLDQYDLASINTFVANGIDQYILSRDCTGSCFYTWN
LYVDNGLSGGIPQRDTTVQGCQQRCINNPTCTGIDIDTNPNHNFCWLHFTTDLFLFPTSG
VSHYQISRSASCPESPGCYVRSLISMNADGGQRYPDPVSNETCALQCLQLYPQCVAADWS
ISDRTCYLHNSFSGRKPSPCCNRYEITCTSTNPAICQDDFIVLPSFSPNLQYLNWQSNIF
NLNDCKTSCLSFGKGCIGVVFSQEGRVIPGVSTCYLVTSIDAMNTSQRSNDFDLYSRSSC
EPYNSAMLTRTCLLDVVFLVDTSGSILDNQPPGLNNMQLIRSFLESFLQSNLKVGPFFDH
IGLITFDTNARIAYDLCDNQVPYSINASGIMKIRQSLGITNTPAAYDLAYDMLFGSGRCG
RAAAQPIIVLITDGHTSPEYREFFAASLAKLVYTRSVRIAIGVTTDVNPVELQQFDSEDI
RGIPILDDFSQLFAMQGVIYNFMAQRCNRPTVATVPIPTRSFTSFSASTSTTTATTTTTT
TTTTATATISTSARQIISTMSYAQNNAFAFNAYLTQSIQGPQEWLRFDQSTLSLSNSYLS
NANGFVSPGPEGLFFIDLGAAVSPGRKLQIDLIVGPNQQRFLNWESTSQNGLITVSRFAV
MYLQSGLLVGFKMPAYDSYLQSDSSTRYGSFSGFSIAHAMTYDANRFALVAVPNVNSFPI
IGENYTIPLRSVVSSLSNNLVNGNTYVCPINGVYVVTFSAGVVYNKKLQLSISGLDPTID
LSRLGTNRNGLTSVSRTSLVKCQQGQQIYFKLLSGQIDDINLTAFSIFQYKPQYVSEQSW
GVYKSYNSDTRDNFPLDPFYFDTPLVNDQGLYDGGNNIVRIQISGYYYVQITAGSQTGFN
VRMRLVRVDGRTGAQNAQDFISHGSIVLLRANDFLKVVADIPSYLYNTIYGYQTSFIGFL
IYPE
Download sequence
Identical sequences T1FVV8
jgi|Helro1|194269 XP_009029559.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]