SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194320 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|194320
Domain Number - Region: 107-195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00238
Family Laminin G-like module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194320
Sequence length 1213
Sequence
MGIRKGIGNGKKLKEIGSERTFPPSMGLTYSSWICVDKFSNAATDAHPVRLLNIVRSVRD
DNLVCLSIYISAKDRSLIISTQETMLSNLASAEMDFDSIAPSTTQITNNSTTSSSTNYNN
TSTTTTTSVTWNDCTTIRMHCPELAQEGQWHHLVVMLHRSGMLKNSSLSVVVNGSTIGTF
KLHYPTPYMVPSTSSYIASIYAFIGTPPCIRRTSQLSWRQGACYLFEDALILSVVQFIYK
LGPNYTGSFQAAILAHDRKDGPHLSSSSSSSSSSSSSSSSSSLINEEKIIFGIHAHAMSV
MTTAKIRKIFNKVDAKNVAKQLGMSAHENASPIRILHNSVGHLAGPARVAKVIMSVAGTS
SLLGLIAMANNIEGLYASVKALVCVVRSNKEACKEMDMNKGYQHLAMIFKKKCRLLNSHI
LHLTFSLVGTVDSGRENSIISNKGAFESLLADLDIWKKAPCDLQKSLYEHFFDLLTESSD
QPWNKNIMLELGLVDKLLNVAYDENISLNAMNIISSVLHNLLSGPNYHSRSLLRFGQFVA
NLLPSNSVDERSFNISSADNPSDVLFDNTGSRSIFIIRLRNLCLDIISKLAFMPSSSSTT
TSSAVPLAHKHFQQLNSQFCEDLHKTLGLDWFLLFLQGHIHSSTVTCSLSLLLCILQHHP
FLQQKFRDGVGCGGWLTDAQCVVVGNRMSLLAGVQIGSRTSREIAMELCSTPGFMCLNWL
LPQHASLSKIYFLLVMFMLNQPITDIPENVEFNLDSIWTQVFKVSDGKPLQVSKLKLEYC
IEAAVIILSLVRTAFSCSSIDQETDSWVKDYPIVALQFFLYLYHNQPDFVPLCMTPDFLN
ALSSTLFLLRSSCLADVNNSESSVDDFRPFSSVEQLSTSAPTSEKAVSLTSHVARKFVVD
FLRRIILNSLALSCTNKSLPVIDVVLEVSPDHSFRQECKQFQTEILNVVMDHLLAADVMM
GEQGALSISGGSSYTQLAANVFYFSGRVVDKLWQGAYTRDPNEVFDFINLLISQAKRKAS
GLCLDNVYKSLNRTILYQLSRPLTSLADFEGVKETLQKLLTNKILIFGPSNFDSEFIGCL
CYCLLQMCDLNPNNINSPQALRTTTWHVEPTTCFEAPANQNAPTSTKDDSSSISSNNNSD
SNNRMLVNDSLQSLASHARKVWDELFISKKPVIEEIFKVTLTASSDPNNVKSCLRQTSST
SSLKYSMQPQKFG
Download sequence
Identical sequences T1FVX5
jgi|Helro1|194320 XP_009029662.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]