SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194346 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194346
Domain Number 1 Region: 153-434
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-84
Family Kelch motif 0.00000167
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|194346
Domain Number - Region: 27-138
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family MIF4G domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194346
Sequence length 460
Sequence
MLRWAGIRNFAHTYNCTALESTANRFILERFKEVAKKGNEILKLTDVELEELLSSDHLNV
KSEEVVFECIVRWIQHDVKNRKQYIAKLLKCIRLGLLSTTYFIETVKKHRLVQDNEQCKP
IVIEALKFLYDLDIVGQEIDFNNPMARPRIPHEVMFAVGGWSGGSPTNVIEAYDTKADRW
ITVDHQDRGPRAYHGCATVNGCIYLMGGFDGMDYFNSVRCFNPVTKEWSEAAPMNSKRCY
VSVAVLDNCIYAMGGFDGHVRQNTAEKYTPESNQWSMITPMNHQRSDASATTTGGKVYIA
GGFNGQECLNTAESFDPATRQWTMIAPMRNRRSGIGVIALDGLVYAIGGFNGITRMNSGE
RYNPTANTWTNITEMYSPRSNFGIEVMDDMVYAIGGFNGVTTIFQVECYEPTTDEWYDCT
DMNLYRSALSACVVKGLPNVEDYIDKVRNQVMQERRRNRP
Download sequence
Identical sequences T1FVY6
XP_009029703.1.102002 jgi|Helro1|194346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]