SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194532 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194532
Domain Number 1 Region: 41-118
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000966
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 182-241
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000058
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|194532
Domain Number - Region: 222-310
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0405
Family MW0975(SA0943)-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194532
Sequence length 503
Sequence
MSEVVQTAPPATTTPATASNGTTTAASSGSSSNKLAQEIYDEFLVCKICLDGYKNPKCLD
CLHTFCETCIETHVNSEPAYKKYSDYREFTCPLCRKRTQLPVGGVKKLPDNFLVSSLTEV
VGRQKPSANPFCDICKLVTKTEKDATSKCLDCSKLLCAGCVALHKNTKVTSNHSLFDVEI
EKEIGCKDHQDEVIRFYCEPCESCVCILCTFNEHRDHAISQFQDVAVKYKANIESLLAHC
KQKITIFETSLEAINKCESTIKQVEQKIRDKSIEYIQEIRNKEKQLLEELHQIYGQECFE
CIDSKKELVHQVENIRNTCNISEVILLGKEIELLLLKKDVEDKLNLMNQIDHKQLPANIS
KLVDFQTGVVDLGYLLHDGSKAAGSKCFVKLRGKKSQTGNTPSSTSSSSSRWMAVSVEGK
EELKEGSEASVAIPIGTNFEIVETTDSAAQTDAAATEAASTAATTAGDKLVKTNSISESD
LIVEDGDGVIRRRRRRMEDGPKQ
Download sequence
Identical sequences T1FW59
jgi|Helro1|194532 XP_009030737.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]