SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|194686 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|194686
Domain Number 1 Region: 41-372
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.05e-58
Family Integrin alpha N-terminal domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 517-653
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-23
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 3 Region: 372-516
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000968
Family Integrin domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|194686
Sequence length 732
Sequence
MTYNCHAGVVLGTETQKLNELVRSPKTSVEVCGHLHKRLIASHSGHGRCIKLSNSLEFES
QTIPCQSIIPGTEYAFCQAGTSADFSPEGSFLMGAPGSKNWRGTFFKRFISKVITNEEDV
FNISIETDHFAPFTKPDGSNITNMYSYLGMSVRSGYVGSDPSKIMHISGAPRSKEVGQVD
IYNSDEQMIHQHTIHGEQFGSYFGHEIVIMDINSDGKDDMIVGAPFYRKQGICGAIYVYM
NEKGITNKVTPQKITSRKMMDTECEKLNCLDARFGFSMASAGDLDGDGFNDLVVGAPYEG
QGAIYIFHGRRSDLSPEPAQRIYAGDLKTPFKALAFGSSLAGSGFDVDGNGYPDILVGSY
ASDTAFLFFSRPVANVKFRFENLPKFVDPMKKEENCKGNACFTMRVCFILSPAKNPSNTM
SKLLLSYSVETDTEPRVRSQFYIEKRLNINFSGQDNIRDYLRPLTYQLTFQAFEKSGPTI
DYQPGGTIPNYNDYPVIVGVKASHILLVHFRKNCGDDEVCSSNLKLQASLNLTRSADSSN
YVLRVGQDRELEVKLAVENKLEDAHQANLYITVPANFGFIGTSGKDTVCSKLEEQNVVEC
SVGNPLPPNERVEFGVRLDPRMALPSKEVIDLKVMVNTTSNEMDSKDNEVTLKLEVIVET
DLGIRGFKKEQNKGKKLDENNKSTSFRICVEKNDLNKIRDPNIWPSGVILRDWIFNQQTV
RAGQRVTSKYQQ
Download sequence
Identical sequences T1FWB5
XP_009031815.1.102002 jgi|Helro1|194686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]