SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|62081 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|62081
Domain Number 1 Region: 16-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000237
Family Laminin G-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|62081
Sequence length 178
Sequence
MQSNAGPTMMCQVGTCHNGGICVQQWSHFYCDCNMTSYSGKLCNESSLGLLFVHPSGGLI
SMMMSDGQKKSSKKDSICFGLQTNYNGNAVIVRLASKTSGDFNNGYMVVNYNMGKSTHCL
DTKMFNASSASNEVDFIDGKKYRLNDNRYHVVRFARSAQNASLIIDDLPPVSYHPTGR
Download sequence
Identical sequences T1FWV4
XP_009009376.1.102002 jgi|Helro1|62081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]