SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|63151 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|63151
Domain Number 1 Region: 172-304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000675
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 265-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 3 Region: 1-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|63151
Domain Number - Region: 128-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 389-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00055
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|63151
Sequence length 530
Sequence
CSHICENVPGSFKCRCREGFELLSDNKNCKQIDINECLEGRKCRDNEICTNTKGSYLCVK
LQNSSCSLGFYFNNVTKKCEDFNECMTALENCPMGMKCINTHGSYTCKRARECGTGYKLN
TVTDECEDIDECVLNIHNCGKSRTCKNIAGSFRCLTTDCAKGHKFSEIFQVYVDECLKIP
QICPQKKVCKNTYGSYKCVDEMVCPAGFFLNETKNGCLDINECGTSLHSCTYKNMLCNNT
IGSYICYCPSGTETNKVLRECVDINECTQKISACSAHTTCENTFGSYRCVCRDGFRLEGN
ECKDDNECARKETCQHICTNVWGSFRCSCKPGYKLAADNRSCQDLDECKIYSLMKGKEAC
RYNCTNEVGSFNCSCPPGYHMTSNFKCVDIDECNKAVKPCDNNKICINLKGSFKCEETDC
GSFYNRNVKEDSTKLCNKKTCNRGDSRCLSSPFVIQYFFLSFSTDIPIPYAITQLTMPQD
SANLFQSKLTNFKSSIQKPYLGSVDKNYFQLTKSYFQVTIFNIHNDLRFV
Download sequence
Identical sequences T1FXB6
XP_009008793.1.102002 jgi|Helro1|63151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]