SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|63300 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|63300
Domain Number 1 Region: 450-644
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-38
Family Laminin G-like module 0.00044
Further Details:      
 
Domain Number 2 Region: 252-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-36
Family Laminin G-like module 0.00045
Further Details:      
 
Domain Number 3 Region: 29-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-35
Family Laminin G-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|63300
Sequence length 670
Sequence
AIQRSFLPMKCHRNLVCLSGGECQELDEAGDFRCKCPLGTTGTSCEQVSSIKYPKFQGIG
HIAFPALKKAELSFNVKMEFKPESETGLLLFTADQPDAKFDFFSISLVSSKIEFRYDCGS
GMAIIKSSNVVKLNMWNMLVINKNEQFGMIQLNNETIARGKSKGNFSRINFQNNLYLGGY
LNLSEVSDRIGIGKGFDGCIRLLQINKKLYDMRKGEFVGDALGGVDVENCITGICNKLTC
FNGGQCVAENAEFPRCDCPLGTSGDQCQTSEFIGSSFLQFTGLRRNVLSFTEIEVHLKPK
KNYGLILYNGYAKDKTGDFISLSIVDGFVEYRFDLGTGPAILRSKYRIELDVWHIVIASR
TGRKGYLKVDDQQLVEGMASGAFTQLTLTLDLFVGGHRNFDEVVPAANINEAFYGCIQKV
LINEKPMKLLLEAITGMNLINCNHACSDIPCGEYGKCTPQLSDFTCSCDLGYAGNVCETK
LDASSISAASFSGNSYLLYVHPTIVQRASGREFMLQFKMKASEESGLIFWVSEEESGPNG
DYLAVGLHAGFLEMRFDLGTGDAHIVHNFTRLDDNKWHFISIHRFERTGFLQVDGQNITK
GFSPGEMKQLTSPGSIFLGGMEDIVQRTLKRYKSGLVGCLQNVTLGGDLGIHLVEDALEG
SNINSCGVYS
Download sequence
Identical sequences T1FXD7
jgi|Helro1|63300 XP_009008707.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]