SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|64184 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|64184
Domain Number 1 Region: 13-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 254-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000174
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 293-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000444
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 331-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 219-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 369-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 60-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 178-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000034
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000389
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|64184
Domain Number - Region: 407-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00183
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|64184
Sequence length 433
Sequence
CPSNFMGVYCQFANPCFPQPCLNGGVCLSINSTASQNSSFICQCPPNYFGTLCETIDPYS
CRNNPCLNGGTCLSSSTGPITCQCLPNFVGIYCGQPNPCLSNPCKNAATCSFSTTSNSFQ
CKCPDGFVDPTCSTIDPCKSSPCLNGVCTSVVSTTVPYAANFKCLCTNTYVGQICNVINP
CLNVPCANLGTCRNTGIYNETYVCDCRPGFSGPQCTLSNSCSTSVCLNNGTCSATTNGFV
CACPPNFYGLTCSEFDPCRVNPCKNNGICIVNVNLFTCTCSSGWVGTTCEIRDPCIANPC
LNNGQCIRNGSNFNCNCPAGYSGTICQTIVNLCSSAPCLNGGTCSLDASGLSFTCTCLLG
YVGERCNSQSPCSPNPCQNGGTCSVGTSGSFVCACTTGFNGPTCSSNPCSGNPCLNNATC
AISAGTFICRLEN
Download sequence
Identical sequences T1FXQ9
jgi|Helro1|64184 XP_009015792.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]