SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|64188 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|64188
Domain Number - Region: 31-78
Classification Level Classification E-value
Superfamily Integrin domains 0.000319
Family Integrin domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|64188
Sequence length 148
Sequence
MTLYNVDLYIYDLSQGLAKTLGSLIFRKPVAGVWHTGVVVYGTEYFFGTQGIQFIQPGGT
ILGHTYRIHNMGKTEVPKELFEEYLRDLADDKFRYDKYHLLDHNCNTFSNEICLFLLNKH
IPDYITNLPQEFKQSPLGNFIKPLLDEI
Download sequence
Identical sequences T1FXR1
XP_009015280.1.102002 jgi|Helro1|64188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]