SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|64249 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|64249
Domain Number 1 Region: 26-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-22
Family SPRY domain 0.02
Further Details:      
 
Domain Number 2 Region: 215-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000038
Family Nucleotide and nucleoside kinases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|64249
Sequence length 441
Sequence
MRFFSLKLFSYFKNCRSEAKNLTAPSGFCFCWGGVKANCGVTRGKVMYEVRILEHLAADF
GENHIETSPHLLRIGWSMVHASLQLGEEQDSWGYGGTGKFSTNNKFSDYGEAYTIGDVIT
AFLDLDSKPASISFAKNGLWLGVASPLHGFKVDQKSHAMFPHILSKNCRFEVNFGQQSSW
CPVQYVNHDHVFINNISPMYTAPGPKPPQSKSDCEVIMVVGLPGSGKTTWARKMFRDHPE
KMYNIIGTDDLIDKMKVMGLPRKNNYSGRWEVLIQQATSCLNKIFFIASRKLRHYIIDQT
NVYATARKRKMKNFVGFKRICAVLQPEDDELKRREWKRTFEEGKVVPEEAVMEMKMNYSL
PDAEVDEHIDEVIWIELGKDASCQLVNQYNEEGSLKLPSRKRLSSTSLPNNSNNSSNNNS
SSNNNVRTKIYYMHLSSCHFL
Download sequence
Identical sequences T1FXR7
jgi|Helro1|64249 XP_009015694.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]