SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|64253 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|64253
Domain Number 1 Region: 254-420
Classification Level Classification E-value
Superfamily PHM/PNGase F 2.3e-42
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.003
Further Details:      
 
Domain Number 2 Region: 100-254
Classification Level Classification E-value
Superfamily PHM/PNGase F 1.36e-34
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|64253
Sequence length 470
Sequence
DAHTDNFGRLQVDKQQNYILEDAQRKNSGRNHQGPLVIKFHRSYDTCDDEDDYIIDKGTT
HLVYFNHKGPISSLDRINLMEEKVIVQRVQLLKSQIPDAPKPTDVRELVVHVDQVPVPLD
ETTYWCTVKKLPNFVDKHHIIKYEGAISKETQGIVHHLEVFNCQIPEGRDVIRYNAPCKS
MAERPKGLESCTKVLGAWAMGADYMTYPFEAGAPIGGPHMSRFVMIEVHYNNPLHISGLV
DSSGIRFYITRQLRRFDAGIMEIGLEYTDKMALPPHLPKWELHGYCIPECTEMALPSKGI
YVFSSQLHTHLTGMKIYTKHIRGGIELPELNRDDHYSPHYQEIRRLHEPVLVLPGDALVT
TCVDQTRNKDNVTLGGFSISDEMCVNYIHYYPLVNLEVCKSSVTTKSLYDFFDLMKRKFD
DDIDLENGISYNYQTIDWTREKVDMLRNFYDTAPISMQCNKSNGVKFPVN
Download sequence
Identical sequences T1FXR8
jgi|Helro1|64253 XP_009015318.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]