SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|64794 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|64794
Domain Number 1 Region: 302-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000724
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 26-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000716
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 383-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000287
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 227-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family EGF-type module 0.035
Further Details:      
 
Domain Number 5 Region: 98-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000629
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 6 Region: 264-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000819
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 422-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 152-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000287
Family EGF-type module 0.044
Further Details:      
 
Domain Number 9 Region: 187-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000471
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 10 Region: 346-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000471
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family EGF-type module 0.0098
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|64794
Domain Number - Region: 6-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00716
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|64794
Sequence length 462
Sequence
SQIGDTYTCLCSLGFAGAQCQNQISQPCYSNPCTNNGTCILNGINTYVCLCLPGYSGSTC
ATKNTCVVNNCLNGGTCTTEFTCQCKQGYAGTACEKNDACSSQPCINGGTCTATNNGQYT
CFCRNGFTGSTCASIPDLCALCETKNPCYPVSPCLNNGVCIDTLNGLSGYTCQCDSQWTG
LNCNVPNSCFSNPCLNNGTCLSSGNSTNYFYTCNCLPRFAGVNCNLINYCLVNPCFNNGT
CRLSNNFVTCSCQPGYYGSLCESKDSCFPIPCLNNGTCTNNGVTGKYTCLCPPQWLGSTC
GSVNPCFVNPCLNNGSCLLIDSANSTSNYRCECQSGFTGPNCNVLNLCAPNPCKNSGTCN
LNDGLVTCTCNQGFFGTFCETQDPCHQNNPCLNNGSCISSSTVGTYLCQCSPQWIGTNCS
LINPCFINPCLNGGSCVKSDGINNSNFTCKCTQNYAGTFCEL
Download sequence
Identical sequences T1FXZ4
XP_009015791.1.102002 jgi|Helro1|64794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]