SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|65080 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|65080
Domain Number 1 Region: 54-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-53
Family SPRY domain 0.000019
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000894
Family F-box domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|65080
Sequence length 261
Sequence
MIVKRPVPVSWANNLPQFILEYLFSYLSVEDLRNCALVCTKWYKILNDENNDVWRLHCVH
KLAQEALNSDLLSHIPSYKNKLRAFYYAWNPNDCSRNIYIKSNGFTLHRNPVAQSTDGAR
SKLGFKNGRHCWEVWWEGPLGTVAVVGIATKAAAMQSQGYLPLLGNDTESWGWNLVDNHL
LHNGDAQGNYPVITTPPTYQVGEKIRIILDCDDNTLAFEKNYEFLGIAFKNLPDVKLYPA
VSAVYGNTEVSMVYLGQPLDG
Download sequence
Identical sequences T1FY30
XP_009019894.1.102002 jgi|Helro1|65080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]