SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|65959 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|65959
Domain Number 1 Region: 9-57
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000749
Family Ovomucoid domain III-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|65959
Sequence length 71
Sequence
MIYNKSRGFVHCSFSLTETCNENCSCPLNSFDPVCGSDNVWYISPCHAGCTNHANNGSSV
SMFIHFFLINI
Download sequence
Identical sequences T1FYF2
jgi|Helro1|65959 XP_009019499.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]