SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|66198 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|66198
Domain Number 1 Region: 114-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000399
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 73-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000435
Family EGF-type module 0.022
Further Details:      
 
Domain Number 3 Region: 4-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000018
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 38-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000294
Family EGF-type module 0.031
Further Details:      
 
Domain Number 5 Region: 157-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.023
Further Details:      
 
Domain Number 6 Region: 190-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|66198
Sequence length 255
Sequence
CDKANNPCFNNGTCLPNDKNKICNCLKDFEGTRCQFVSCAKENPCANNGTCVIKDDKKEC
VCKANFVGKYCNITSCASANPCRNNGTCNTNDFNKYCTCQPGFTGQFCENDIRNPCTKQP
CKNDAICIPAPPINNTFTGVYKCKCQFGYTGKHCETYNVCKNKPCRNGGVCNMNQPNICT
CLPGYSGMFCTSCRAVICQNGGKCNDNKQNICDCLPGYTGTYCELSKFCLGVLKFNFNPY
LIHVHSSINNNNNNR
Download sequence
Identical sequences T1FYI4
jgi|Helro1|66198 XP_009019833.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]