SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|66974 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|66974
Domain Number 1 Region: 10-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-16
Family Laminin G-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|66974
Sequence length 205
Sequence
PAISCSDVSCSHGGLCTDQSGVPECDCTMTSFFGSTCDEGHIAYQFNSKSDKRPSTLTLD
LPERDWTTTSVDVIVFGIITNQSDANLWRLSSNTSRDFIEAIIVSVQTLFGYLSLSLDDG
HLMIIYDVANEQLPVGLFFHRIDDGKYHVINFVRIGPNATLKVDDHMPQPKQPQGDDDDD
DDDDDNDDGDDGNNNNNGNICILFS
Download sequence
Identical sequences T1FYU3
XP_009022505.1.102002 jgi|Helro1|66974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]