SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|68144 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|68144
Domain Number 1 Region: 11-121
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-24
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 2 Region: 149-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-19
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 292-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000353
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|68144
Sequence length 338
Sequence
CTYDFSSERRSRGQFFSPKYPQNYPPNSNCKYYFHAKPYEKVALIFENIQLEYIEGRLVC
ENNPDRIIIKDGFEPASPVITQFCNSSHFHEVTSSGSKMAVEFISDFRKQFQGFAASYRF
ISPTFPIHNLQQSTCDQHITSSHPEPHEITSPGYPNSYPSTPTMCHYVIEGESRQRIQLT
FTEIDLHPSDDKMPAENELCEETDIVTIHSFIDHSSEVMKTYCGRKNSTKAFMSSNNRLE
VVFTTRPRESNELINSRGFKATYAFVTNYGIHYGIQERDLSCSFSYHSDISATGNFTSPN
YPGLYPHITECHFLFYGRQHEVIQITFETFDVEGVQNE
Download sequence
Identical sequences T1FZA9
XP_009025192.1.102002 jgi|Helro1|68144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]