SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|68539 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|68539
Domain Number 1 Region: 74-302
Classification Level Classification E-value
Superfamily Kelch motif 4.05e-51
Family Kelch motif 0.0042
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|68539
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily Kelch motif 0.0523
Family Kelch motif 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|68539
Sequence length 476
Sequence
MTHWIAHLEGGPRRVNHAAVFIKSHIFSFGGYCTGGNFEVAKPIDIHALNICIYATLTLF
YYHTFVNELERLKVPFHRYGHTAVNWRDRAYIFGGRNDRNGACNKLFCFDPETLRWSRVS
TKGEVPGARDGHSASVLNDKMYLFGGYEDALQRFSNDMYTFDFRLSQWSLLSTTGTPPIW
RDFHTSSVIKNFILIFGGRSDEAGQFHTNSEVYCNKLVTFDTTTNVWTQPKVKGYVPYGR
RSHTAFVYRDEMYIFGGYNSLQDVHFADMHKFNLESNWWVSVRVYGRGPGVRRRHCCCVV
DDDAGGGDRRGGATGGSRVFLFGGTRPLPMSLQPFVLPTDELLVDLSDLHVLQFKPSLKT
LSMLVIIEKKLDTSCLPAMLRFDVVVRVCVCLVCVCVRVCGLCVCVCLVCVCVCLVCVRA
RVLCCACVVLDTNNNNNNNHIIYININIININNNNIKNNIINSNINNNNIINNNNN
Download sequence
Identical sequences T1FZG5
XP_009025248.1.102002 jgi|Helro1|68539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]