SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|69601 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|69601
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000226
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 2 Region: 36-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000135
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 75-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|69601
Sequence length 123
Sequence
CFSNPCLNDGTCLDVSSEGDYVCKCKPGFSGTNCNNVCYPNPCQNGGTCKDFVEDIKYTC
TCPPGFYGKDCQLTCSPQNPCQNVGTCVETDDGSDLQYFCICKPGFYGSNCQIGNFFIMN
FLL
Download sequence
Identical sequences T1FZX0
XP_009028845.1.102002 jgi|Helro1|69601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]