SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|69899 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|69899
Domain Number 1 Region: 158-399
Classification Level Classification E-value
Superfamily vWA-like 8.15e-65
Family Trunk domain of Sec23/24 0.000021
Further Details:      
 
Domain Number 2 Region: 26-76,400-494
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.02e-57
Family beta-sandwich domain of Sec23/24 0.00047
Further Details:      
 
Domain Number 3 Region: 602-749
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.49e-24
Family C-terminal, gelsolin-like domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 4 Region: 496-601
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.92e-24
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 5 Region: 75-157
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 8.5e-21
Family Zn-finger domain of Sec23/24 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|69899
Sequence length 750
Sequence
MKVPEVAVYNLLQERNILPKDGFEVATPSMHDVRKTNCHPDLMSCTANVMPNSNSLLQKT
RLPLGLLVHPFKDLSNLQVIQSCSIVRCRSCRTYINPFVVFVDPSRWKCNICFKANELPS
DFCYDSTTNTYIEPHKRPEVKVATVEYVASTDYMLRPPQPAVYLYLLDVSFNAVETGYLS
EFCEILIKELDRIPGDSRKQIGFIAYDTSVYFFNLSDEHNQPQILCMPDLEDADIPCPDG
LLVNLEESRDIVLDLLEKLPAMFSNNTEVGSCLGTALEVAYKMMTSTGGRVTVLQTHLPT
VGAGALKNREDANERVSKNIQGMGPVTDFYKKLALECSAQQICIDIFFLNSQFTDIATIS
CASKFTSGTTYYFPGFHRATNLAELRRFRSALTRYLTRKIGFEAVMRVRCTRGLNIHTFH
GNGFVRSTDLLSLPNVNPDASFGLQMSIDDTLESNYVFFQAALLYTSSKGERRIRVHTLC
IPVSSVLSEVQASANQRTIISLISKMAVDKSLSVGLGDSREALVYAALDIMQAYRASVPQ
GQRLANQLLAPQSLKHIPLLVLALLKFMAFRIGISTKIDDRVYAMELCKWLPLKQLLLHI
YPALYPLHNLTEEQVCVCEDHVIRPSMTSLSSHQIDRHGAYVMDAGSYLYLYLGSAISDA
FCAHLLDVRSFAGTAEGYLELPELDNNLSLFVRKFVEKLNHKRTVEAPLMLIREDGKLRH
MFYQHLVEDRTESSFSYLEFLQHLQKEIKV
Download sequence
Identical sequences T1FZZ4
XP_009028869.1.102002 jgi|Helro1|69899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]