SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|70552 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|70552
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000763
Family EGF-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|70552
Sequence length 68
Sequence
ELNECASNPCLNAATCLNLVNQFKCICTDEFTGTHCQHGNDDDDDDDMMMKMIVAMMVMI
VQTMLKVV
Download sequence
Identical sequences T1G082
jgi|Helro1|70552 XP_009030151.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]