SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|70577 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|70577
Domain Number 1 Region: 24-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-27
Family Legume lectins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|70577
Sequence length 171
Sequence
MDDESTKNTFSTTQPDRIKQLYPMVDECETPLPRQWSSKKNEKCPSLGLSNNDLRVFYKG
TGKDVKDAASIRTTHSIPVTCGIYYFEVKVITKGREGYMGVGVTAVQKMENRLPGWDKNS
FGYHGDDGNSFCSSGQGQPYGPTFSTGDVIGCCVNFIDNTCFYTLNGDNLG
Download sequence
Identical sequences T1G087
jgi|Helro1|70577 XP_009030156.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]