SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|71321 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|71321
Domain Number 1 Region: 216-394
Classification Level Classification E-value
Superfamily MIR domain 2.35e-34
Family MIR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 683-798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000115
Family Galectin (animal S-lectin) 0.064
Further Details:      
 
Domain Number 3 Region: 406-548
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000353
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number 4 Region: 98-185
Classification Level Classification E-value
Superfamily MIR domain 0.00000115
Family MIR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|71321
Sequence length 1018
Sequence
KYREQDDMICLNCTPSNLGKEAHSNTDRVCLAAEGFGNRTCFLQNMSNKDLPFDISVCVF
VLEQALSVRALQEMVSAKNQETVRLFFSGQSSGHRTLLYGHAVLLKHSHSNMYLSCLSTQ
SSSSDKLAFDVGLTLTTEGESCWWTIHPASKQRSEGEKVRVGDDLILVSVASERYLVSSH
IGADCQVIASFQQTLWTVQPISSGIVRQKSMGHVLGGDVLRLFHGDECLTIPVREVDTTQ
STVMYETGSVASHARSLWKLEHIRTKWAEACMGWNQPCRLRHVTTGRYLASTPDNQIVTY
HKDLSTEDATAFFLKQSKMDKDDKKLSEGHEAEGMGSAQIKYGDSLVYIQHKKTGLWLSY
QTFETKKRGVGRVEEKKAILMVEGHMDDGLTFLRAQEEENKSARVIRKCASLITRFVKAL
ESLKTEGRVSHLWEDISLTEVVKTLEDLIDYFAPPGKDLDFEERQIRLKALRNRQDLFQE
EGMITLILQTIDKCSQWKSMRRLSHLIGEESAAVWNDMINYLYLLLAALIQGNHSNCTQF
ASSKHIDWLVRRLEGQDSSKGVLDVLHSVLIDSPEALNVIKEHHISTIISLIDKHGRDPK
VLDVLCSLCIGNGVAVRSNQNLIMENLLPGKDLLLQTKVVDYVFSMNPNIYVGKCEGSAM
YHKWYYEAVIDLVEQVVTHLPARVRIGWANTEGFVPYPGGGSHWGANGVGDDLFSYAFDG
VSLWTGMSDPRLARTSHMSLQKGDIIGVCLDLDVPQMTFTINGIPVKGFFKDFNTTGMFF
PAISMSAKSSIRFMLGGEHGRLRFGPPDSHSPVCESLKPKEKLKIEPCFNLGNVPKGLIS
GPVQLTEHLTFVPNPVETSHVMIPAYVENVTEKLAENLHELWTMSKIENGWIWGERRDDQ
RKIHPCIISYDKLSITEKQTKNNQKKTKTYRMLLALGYHITFDPQYTSNHRLKTQKLSVN
YTQANGFRPAPLDLSGLVMSEKLNELVEALAENTHNVWAKERIKQGWTYGLTEVLIDE
Download sequence
Identical sequences T1G0J6
jgi|Helro1|71321 XP_009010147.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]