SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|71772 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|71772
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000249
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 999-1064
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000706
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 3 Region: 324-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000356
Family SPRY domain 0.031
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|71772
Domain Number - Region: 888-978
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0732
Family Formin homology 2 domain (FH2 domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|71772
Sequence length 1734
Sequence
GRKWHMGSELYGKIWQKGDIIGCMLDITDRTISFSLNGELMMDRMGQEIAFKGIDVSEPY
VPAISLGANQHARVNFGQDVFSLKYFTCCGLQEGYEPFCVNMTRPMPLWYDKEQAMFENV
LKDHPRLEVVRVPGGCCYLQQPQQQRNHNYYNSQNNSHNKIFLPPTNTGDYLPDKRLFNK
MGLKFGGAADGMGRGGFHGAKRGNVGPYPPSSTSSSHPNARGPSVSQGVGGGVRMRKKRD
SQGSFGSDAMESESDYRDLEAHMDVIDEYYYGVRVFPGQDPSQVYVGWVSPHFYTHSRTF
DMKSMRNVVVTTIDVENQINTSVIRKNCYMVSAGDLHNSHQEDSGKKAGPGLLIGCHIDV
SSGLLSFTVNGQEAANKFQVEPNAMLFPAVFFEPTNKEVLQVELGRTKLALPLSSILFRG
GKHVVPQCPPRLDFQWLKTYQWSRCPLSSNKVHVLKLSDVRGWSMLIEDADQMMALHIPE
EDRCLDILELKEHPDLLNFHMHTLDLYHAVCSHGNHRAAHELTQHVNERQLMFCIKSKYM
PGELRMGFHNLLISLHLDSYAKTKLMTQKEFIVPLAFAHKALQLFNKTSPTSTAATSAAT
ASLSATQSPQASNQPSGGLTMALPATTPSSTPAATSSPYFPLNLLKQCMMELLTEAVQKG
AGHIRDPIGGSNENHFVPLIKVVDNLLVIGLLDDNDINQLLYLIDPQNFYMKQSQGCFGL
EIIDIIAKKYGLIQIKLSEPVKLELCTLLHHLCDLQLRHRIEALISFSEHFVGGCQMEQK
QRYIDIKQTDMPMAVAAKRTREFRCPPQEQMRTLLSCKEESDDCQSPMGDDLKERLFEFH
QELLRHCNHNPPEDEEAESKKATQVQAEVETNKSILEKVYNYITNKAPPAPPPPPNNIQQ
LITSTVISWAKTNIVDQELIRAMFSLLHRQYDGVSEMIRSLEKTYVISEKSREDINNLNK
SLGLVRSLLMVQVAPEEEEQLKSCIWNLADNKVFFQHPDLMRSLGIHETVMQLMINTLNK
AQQQSAASESDMVVACCRFLCYFCRTGRVNQRAMFEHLAYLLDNSCMLLSRPSLRGSCPL
DVAYSSLMDNNELSLALRESDLDKVAVYLSRCGQQSNQKLVANGYPDLGWDPVEGERFLD
FLRFCVWVNGESVEENANLVVRLLIRRPECLGPALRGEGGGLLKAMHNSIIMSLQIAAAK
NPNAIQFIRAYDFSTLPPEDDEDYIDIGAACLQFYSSLIDLLGRCAPEAEAIKAGRSDSL
RARAILRSLVSLDDLEGALEIRFILPVGNIQPVGKNQPPPPPPLPSGLSPPHKTAVVLFL
ERVYGIQDQRTFFRLLENGFLPDLRAATTLEDAQEGDGDMALALNRYLCNAVLPLLTNNS
HFFHDADHVCHLLDQTLHTVYKLSKCKSLTKNQRDTVSDFLVALTGQMRPPMMTSLLRKL
VVDVPALTENTITPLRVLVNHYERCGGYYGSGGWGSHGSATEEEKRLTMMLFSGIFDSLA
KRGYDPELFSKALPCLSAIGCALSPDYSLDNQDDGFYKQCMAEAEWSYVPQPADISKYVI
HIFNIFLIFPQKIDSGWTFGTNYDEELKQHPNLKSFQLLNNTDKSRYLSPIESSLKAMVA
WGWTVELDPSRSASKAQIKKKQSKLSLGDYTPRPADLRSITLTRGMLEMAERLADNAHDV
WAVKKKVELDKLGGAINPQFIPYSMLTDKEKKENRERAQELMRYMQMCGYRIIR
Download sequence
Identical sequences T1G0R3
XP_009010146.1.102002 jgi|Helro1|71772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]