SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|72015 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|72015
Domain Number 1 Region: 334-464
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000487
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 53-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000882
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 168-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000185
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 4 Region: 626-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 7-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000377
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 208-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000429
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 844-875
Classification Level Classification E-value
Superfamily Notch domain 0.000000445
Family Notch domain 0.0029
Further Details:      
 
Domain Number 8 Region: 682-720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000499
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 270-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 518-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.024
Further Details:      
 
Domain Number 11 Region: 131-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000661
Family EGF-type module 0.045
Further Details:      
 
Domain Number 12 Region: 805-837
Classification Level Classification E-value
Superfamily Notch domain 0.000017
Family Notch domain 0.0027
Further Details:      
 
Domain Number 13 Region: 462-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000738
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|72015
Domain Number - Region: 312-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 604-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 544-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|72015
Sequence length 900
Sequence
MNANATGEICEENIDDCINNKCMSNSTCVDQADGYRCRCLPGSGYTGKFCDEDVDECLKS
PCHNQGTCNNQPGSYTCSCLNGYSGRHCEVDVDDCESNPCLNGGTCRDSVGGFHCECPPH
KSVLCQYDNPCTRTMNICKHGTCVTDADTAGWLCRCDSGYQGKDCSEDVDECMMKQNPCD
NDGKCQNEYGTFSCKCKTGYTGTRCETNIDECLQVQCHNGGACLDGIGTFKCACTSGWFW
TFCILYHVFCVGCPTPPIFKPTPPHAGYTGKFCTEVVDNCPSINCNHGRCVNEEGGYRCI
CDPGFKGLADHHCLKRCLNGGKCQQQLQQPRCLCHPGYAGEFCQIEVNECSFHPCLNDAI
CFDFMDSFVCECKPGYSGQRCQTDDDDCSERSCLNGGTCVDQVNSYTCKCPVGYHGDRCQ
WEMTPCSSAPCLNDGTCVPSENVFERFCSDGFTGPRCETLKDMCAVNNGGCHQQSTCKQE
SNQIICVCSAGWTGLKCDMPAGSCQEAAIKKNVPAIALCQNGGQCRHSHRGHSCKCMPGY
EGSYCEFQVHPCSPNPCKNNGVCLDRNFFNKNLKTSKFAGGNLENKNSSSSTSGSKGSSN
NIDFDIDGFTCKCPVEYEGKLCEKPVDHCRDGPCLNGGSCYSGSAGFLCSCPVGTHGDRC
EITINACEISTTATTLTTNNHTTTTPNKCHNGGTCIPNYKGAPGYRCLCPPGFTGRNCQG
KLSGCRLKPCKNGGKCWKVRSNDVASHGNNNDGSGGNNAAQCEDNYYIIANHHQHHHQHH
QHHNHHSLTSSSPPPSSLPSPGNLYCIFNGCHWKAGDGVCDEECNNKNCLNDGGDCESTD
PFQSCNVSTCSQTFNDSVCNQECNNIDCLFDGFDCLDRDRRQTCFHEDYCSYHYADGNCD
Download sequence
Identical sequences T1G0U1
jgi|Helro1|72015 XP_009011066.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]