SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|72857 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|72857
Domain Number 1 Region: 14-98
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000555
Family RING finger domain, C3HC4 0.0087
Further Details:      
 
Domain Number 2 Region: 163-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000794
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|72857
Sequence length 207
Sequence
MTTASSFVDEVYGQFLVCPLCSELYKHPKVLTCLHTFCCECLENYYEMEEQERPYRFLLY
NRAISCPICRQKSELPTGGIGRFPENFLVENLSNVIKKRMPSNEKKEEIFCEICRETDES
GKQRVAVTRCLDCVKHLCEFCSDLHKKTKVTQFHALFDMQIEKSVQCRTHSDEIVKYFCE
PCDECVCILCAFHQHKNHEVSTIAEVL
Download sequence
Identical sequences T1G162
jgi|Helro1|72857 XP_009011744.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]