SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|73048 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|73048
Domain Number 1 Region: 7-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|73048
Sequence length 137
Sequence
FSSLYLKSSTFTSPNYPSPYSNDVTCKYTFVGSVKERVQITFNDFHLAHPTLKDDQQSKG
TQSDYVEFSNFNVQVADRKMGRLCDVKDGLSRYVHSDGDFFRVTFKSNYIYDGTGFKALY
QFKKSDGRLHIHVYKML
Download sequence
Identical sequences T1G191
XP_009011743.1.102002 jgi|Helro1|73048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]