SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|73849 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|73849
Domain Number 1 Region: 282-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 2 Region: 344-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 407-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|73849
Domain Number - Region: 94-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0383
Family Galactose-binding domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|73849
Sequence length 456
Sequence
MSLKISSISTKFHVVLIFIIFLSRVSDASNDVDENNPCYNSEGVAINCQPEFVNAAFGKS
VQATSTCGSPAHEFCAQQRQKQQQNGVSSCFVCDTSNPVLSHPPSHLTDPHNSNNLTCWQ
QQKLRYNLQETNLTISLGKKFEVTYVSLQFCHTRPDSLAIYKSSDFGQTWIPFQFFSSQC
EHVYGRKPRNQTNKWNKQEAFCSEDFSQTTNFVGTSRVAFNTLEGRSSNNELDANPILQD
WQTATDIRIVFNRLNTRDISPTAQLNSYSFYSMSDVAIGGRCKCNGHASRCAPVAKSRYS
KEVKLVCQCQHNTDGDDCERCKPFYMDRPWSRGGRTNTTECVACNCNNHSNKCHFDPEIF
ALTNNQTGGVCEDCLHNTVGRNCHQCRKGYYRDLSKLLTHKHACKKCHCHQSGSVESSCH
PETGQCPCKPGVTGLTCNRCAPGYQQSESILKPCVC
Download sequence
Identical sequences T1G1J4
XP_009012568.1.102002 jgi|Helro1|73849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]