SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|74072 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|74072
Domain Number 1 Region: 272-433
Classification Level Classification E-value
Superfamily vWA-like 1.96e-25
Family Trunk domain of Sec23/24 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|74072
Sequence length 483
Sequence
MCCIIDEKSNEPIPLKKINVNITIKGFVASVESLLTFENNGDKQLEAVFKFPIDDGSAVY
KFEADIDGRKIVAECQEKKQAKKNYDAAVQSGHVATLLEEEDFVSDIFICKIGNLLPKKT
AVVKFSYVTEISIQADGSLKFVLPTLLNPRYNPDVSKGGLEKSPSIKRVAACDQPYEFVV
NATISGLDILNVTSFKDKILSSLVNGSTEVKLQDKFVADHDFELEIAIKEPHKPFAVMEK
GSEDKDGILKQDIVMLNFVPELDESAMSSQHEFLFVIDRSGSMDGSRIESAKESLLLFLK
SLPPDCYFNIIGFGSTFELLFKEGSEKYTKESLEKALEHQKTLSADLGGTEILEPLVSIY
SKPILPTHSRNIFLITDGEVFNTEAVVSLVQKHSHDTRVFTLGIGEGASTALIKGVARAG
KGKAEFVKSDDKMSPVVIKLLKCAMQSTFTNIKIDWQLNGASCIQIPKVVPPIFHNDHTV
VYA
Download sequence
Identical sequences T1G1M0
jgi|Helro1|74072 XP_009013083.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]