SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|74310 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|74310
Domain Number 1 Region: 37-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 156-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 93-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|74310
Sequence length 206
Sequence
VTSSSLSTSSSSSPSSSSSSTFTRRLSLSDVVILARCMCNGHASACLPNSSSSSICQCEH
NTMGDECNACKPFYQDRPWRRGDLEDSHECQVCSCHSHSHRCRFNADLYRISGLKSGSLC
IGCKHNTAGKHCHHCKIGYHRNQKLKIESAFACIKCDCHVIGSRDPICDHVTGQCTCKTG
VGGLRCDVCLEGYVQTKSPVNPCLSW
Download sequence
Identical sequences T1G1P6
XP_009012796.1.102002 jgi|Helro1|74310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]