SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|75143 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|75143
Domain Number 1 Region: 281-485
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-57
Family Kelch motif 0.0000138
Further Details:      
 
Domain Number 2 Region: 11-127
Classification Level Classification E-value
Superfamily POZ domain 4.45e-34
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 3 Region: 486-565
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-23
Family Kelch motif 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|75143
Sequence length 585
Sequence
MEEEQENIFIDKFHAQFMMKKMEEYFDSQILCDVVIVVGDLLIKAHRLVLSSSSDYFAAM
FTSDVLEATQEEIVMKEVDPESLHTLIKYMYHGSLDIREETVENLLCTACLLQLSGVVNA
CSNFLEKQLHPSNCIGIRQFADTRGCSNLFRVSNDYVIENFEKIINNQEFVHLPPDDLSQ
LLSDENLNVSDETVVFHALVHWANHDVQARKHALGKLLACVKLPLLSPQFLADHVEMNRL
FKDDPVCQELIFEAMKYHLLPERRVAMQSSRTKPRKSTVGTLYAVGGMDCSRGAISIEKY
DLRTDTWVEFANMNGRRLQFGLAIIDDCLYVVGGRDGLKTLDIVECFDPVRKTWSLVMPM
GTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQAKQWCYVASMSTQRSTVGVAVLA
NKLYAVGGRDGSSCLRSVESFDPHTNKWTLCSPMSKRRGGVGVAACNGFLYAVGGHDAPA
SNPKSSRFDCVERYDPKTDQWTLVAPISSPRDTVAVCLLGDKLFAVGGFDGQQYLTDVES
YDPQLNIWTTVKPLCTGRAGACVVHPTNKTSPKPPLVIGGHTCVS
Download sequence
Identical sequences T1G213
jgi|Helro1|75143 XP_009013976.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]