SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|75164 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|75164
Domain Number 1 Region: 89-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000679
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 156-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 53-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000726
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 321-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000015
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 362-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 6 Region: 13-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 130-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000466
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000146
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|75164
Sequence length 438
Sequence
GYHGTMCEIENAKSACYRNPCHNAGSCSLNGALHKFKCSCSPGYIGKLCQYRNHCSSQPC
HNGGKCYATETSYTCECPRGFIGLQCDDDVDECLQKREMCRNGGTCLNLIGGYKCTCLAS
YTGQHCESPYYPCSPSPCFNGGTCSPTSLTTFICACLEGFTGPNCKENIDDCQGNKCGPN
STCLDGVHGYTCLCPPQYKGQFCTEDVNECQKNPCKNQGTCHNKRGGFMCACVNGWSGDD
CSANIDDCQGKVCYNGGTCHDRVGSYYCECPPGKTGIRCHLDDPCLSNPCHPESRCETSP
DSGHYVCMCPHGWSGDDCTQDANECLQSDLSPCEHDGVCINTPGSFRCQCTPGFAGERCE
VNVNECESNPCQNGGVCLDGVGRFKCACLEGWLLAILWRFCGDFVAWWWFFGGSVWCGVC
HLCCCCLLLFVFVAAVFV
Download sequence
Identical sequences T1G218
XP_009013847.1.102002 jgi|Helro1|75164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]