SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|75318 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|75318
Domain Number 1 Region: 228-360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 439-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000911
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 3 Region: 202-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000569
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 24-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000887
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 113-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000309
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 6 Region: 170-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000712
Family EGF-type module 0.022
Further Details:      
 
Domain Number 7 Region: 400-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000401
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 8 Region: 366-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000191
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 550-578
Classification Level Classification E-value
Superfamily Notch domain 0.000000602
Family Notch domain 0.0052
Further Details:      
 
Domain Number 10 Region: 502-534
Classification Level Classification E-value
Superfamily Notch domain 0.00000127
Family Notch domain 0.0024
Further Details:      
 
Domain Number 11 Region: 62-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000444
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|75318
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00219
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|75318
Sequence length 629
Sequence
MEFVNSFACKCISGFSGTLCQTNDDDCTDSSCLFGGTCVDQVNGFKCVCAPGYTGSNCQH
RLDSCQQHPDLCLNSGVCVSVLDINSNEDRTLNQVVKSFAKCYCSKGFTGPRCEEVVDWC
ARAPCWNGATCLSFVNQFECKCRSGFSGALCDVRMVSCHAAATAKKTTVEELCQNGGTCS
DVGNTHHCACRPGFEGSYCQIETDECLSMPCRNGATCLDRVRAYECLCPAGFQGTQCEMN
IDDCENNPCQNFGTCHDMVNTFHCSCPHGTEGLLCEINVNDCHKDTCLNGGSCRDKVGGF
ECICPPGFSGPRCEGDLNECTSNPCSLHGSFDCVQLPGDYKCLCRIGWSGKQCERRVSIC
SLPKIAHMCENGGTCVESFNNSYYCMCQKGFSGDRCQYKHTQCNTNPCLNGGTCQSNKQA
FQCECPIGIGGERCQYDVVNECFSNPCQHGGTCQDRLSHYTCVCAQFWNGLNCEVFDSDF
KGGVGYMEDVVMASSKQIQHPDCAINNCSAKAGNGICDKECDYAECNYDGYDCSYKSHIY
HSCSAVRSHVVDCNKLFQNGVCDEACMDESCLYDGMDCLPEPKRTCDLLYESYCSNHYAD
GFCDQGKKTNNFLLIKYKNEVKYYSNEKI
Download sequence
Identical sequences T1G236
jgi|Helro1|75318 XP_009013849.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]