SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|75352 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|75352
Domain Number 1 Region: 61-192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000135
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 187-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000322
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 224-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000024
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000259
Family EGF-type module 0.0022
Further Details:      
 
Domain Number 5 Region: 263-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000401
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|75352
Sequence length 309
Sequence
ECESNPCQNGGVCLDGVGRFKCACLEGYEGIYCEINMNECSSNPCEHGSECVDGVGMYEC
ICRKGYVGQNCQTKVDGCSEGPCFHGATCLETDESFKCVCPDGYTGELCDSDIDDCLGVR
CGKGKCTDQLNSYKCECDLGYIGQKCDVEVNECLSTPCLNGGTCKDLVGSFQCICPQGTN
GTRCEHDSNECLSNPCQNGASCLNKINQFFCQCQPGYTGDLCETDVNECESNPCQNGGLC
YDRVNGFKCKCPKGYNDYLCASNVDECLSNPCYNGATCVDGVNRLDWLACRGRLVGCLVD
FLLVGWLIC
Download sequence
Identical sequences T1G240
XP_009013848.1.102002 jgi|Helro1|75352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]