SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|75655 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|75655
Domain Number 1 Region: 141-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.92e-18
Family Laminin G-like module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|75655
Sequence length 753
Sequence
GKVCSFEILTKGVPFEVDEKGVVKNTEPLDPAKQEVWQFSVVAKSCDPHDLPSDEVKVIV
KVKPACQAEWIGIRERMDFSPHDGKILIAPEAELDTCDDKCNVTKATVSIKLNTEHIGKG
CDRDTYSLHSQRKLCGANPEAVDLLPSPLAPDSWTRNLPTDDGKESDEVFAFDGKHDSVI
VPLQIKLGREFSISTWMKHDDDDEDEGDSESIHRKENILCISDNEEMNRQHMSLFVRRCH
LVLLLRQEPDSGLEQDGFAPAEWRWSLPEICDGSWHHYTVVAPLPRAKLFVDGKAFIENK
KNFNVVNDFPMHLTKKVHSTKVAIGGCWMGGMQHVSNHFKGYLAGLSLLNNRVESNSAIQ
CLTRCQEKLDFNAVEDMDSGMAVSMNSDMTSITINGPSLKNVETLLRKISYVNTRNFPTP
GHRPVTFDTELTCSNGRHLEVAPLKSLLIVSRVEKPVITLNAVLNIQEEAEEISKGVGFL
KDFQIFAHSKNQADEYNLDSCSIHMPDPLSSQLEQIKPPLDLVKQLGLNVKVTGNGVVIS
GVDKLENYERVLSGTLYAHANPLNLNQRKFKVSCSELNGRYSSNVLEVVQPEPQSSLSDK
LVQPAGNVQPSVDKQGQGARLKAVTTGQSAAAGVVIVCIICIGFIVLLATVGISRIRNAQ
RHSNVSGLEDKQEMEWDNSALTITVNPMDQEHHRRRRLHHLRHNDDDETDVEEEDEEEEV
VSDDHEDDEDGDGVMESKMKKSELEWDDSTLSY
Download sequence
Identical sequences T1G284
XP_009013711.1.102002 jgi|Helro1|75655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]