SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|76021 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|76021
Domain Number 1 Region: 6-157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-23
Family Laminin G-like module 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|76021
Sequence length 190
Sequence
MIFGAKGGLVTFNFHEGQIMDEKDDRMAFAFKTSQEDAVVVRISSSKSSDYFQVEIMDGK
VLAVYNMGFVDHVVGDFSRKVNDNLYHVIKIYRSSLNVSMQIDDWSPVFKTPSGRQIGVF
NQVSQIMIGGKRESKGQVNRGFVGGVRGLWYDGVNVGELMSRGDWRVKIEGDVTMTVRNE
KNSQADLSKE
Download sequence
Identical sequences T1G2E1
XP_009014173.1.102002 jgi|Helro1|76021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]