SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|76869 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|76869
Domain Number 1 Region: 1-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 73-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000553
Family Laminin-type module 0.086
Further Details:      
 
Domain Number 3 Region: 120-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|76869
Sequence length 199
Sequence
CNCNNHQYPNTTCDALTGKCVCTHHTTGDHCELCSPGYYGDATLGQPDSCKPCMCPGNVN
DMNASALVHSSLRTCNTTSATTYVCNCDPSYIGDKCDKCADGYYGTPDNPNVRLRKCQWC
DCSNYNDGSCDSVTGNCTKCDKFTTGVKCQQCMPLYYSPNITLSKQCYRSFAVVFCCCCC
LAVCCCCLLLVVCCWRLFS
Download sequence
Identical sequences T1G2Q3
XP_009015062.1.102002 jgi|Helro1|76869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]