SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|77153 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|77153
Domain Number 1 Region: 358-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000945
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 2 Region: 436-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000358
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 475-509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 398-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 318-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|77153
Domain Number - Region: 247-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00393
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 220-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|77153
Sequence length 510
Sequence
MSTFELQLTLFQTSQPPSSSSSSSSSSSSSSSSSSSSSPPPCSPSNRCNVFFKICLTHQQ
PVMKLKNFPEAGPGGYDCTFGSTVTDVLWRNNSSNMHHTVRLPISYKWTHKFALIIEAYH
MDDDNNHNIQQGLLLKLILLKNVTSEQGWITESFHNGSTKLDYRYRLVCLHNIYGPFCSN
SCVARDDSLGHYRCLRNGTKSCLQGWTGEWCLNGVLTASCDRCIHGKCTEPNTCQCSSGW
MGAHCDECIPDPACVHGTCTAKTKCVCKQGWGGPLCNQDLNLCAKKPCLNGGTCMHRGVG
YYHCVCPNNFSGTNCERPIDDCNVRANPCSGRGRCLVSRRQYRCTCQEGYDGYNCQDEVD
ECASHPCFNGGRCIDALHSFQCICKPGYEGPTCETQSKRCTPNPCLNGAECLQLAADNFE
CRCRHGYHGPLCQDHVSRCAELPCSNGASCVDLFNTYKCLCMPGFSGDNCEVRKDLCAGS
PCLNGGMCISATDSVLCRCLSGFHGERCEF
Download sequence
Identical sequences T1G2T6
jgi|Helro1|77153 XP_009015118.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]