SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|77204 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|77204
Domain Number 1 Region: 36-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 89-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 137-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 4 Region: 2-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000977
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|77204
Sequence length 197
Sequence
MGICSGCMYNSTGKQCELCIAGYYVNPNGNITTMTCSCSPVGSMMISTPCNASTGQCVCK
QNVKGQHCDTCVDGFVALDASKPDGCSSCSCDPIGSYNNSCQQRGGQCFCKPNTLLRNCS
QCKVNSYGFGINGCTECGCHPNGSASMQCAEGGNCTCRPNVIGGKCSQCIDKNYGLASGL
FIYLNFYFICCIFTFNF
Download sequence
Identical sequences T1G2U4
XP_009015061.1.102002 jgi|Helro1|77204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]