SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|79117 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|79117
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 38-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000352
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|79117
Sequence length 81
Sequence
DYCFQGLCRNKGKCIDLKDGYRCECQEGFSGKTCKIEDACSSRPCLNDGMCALDGTSYKC
NCVKGFTGATCGKEGGFGFYF
Download sequence
Identical sequences T1G3K4
jgi|Helro1|79117 XP_009017463.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]