SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|79313 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|79313
Domain Number - Region: 164-216
Classification Level Classification E-value
Superfamily PHM/PNGase F 0.00837
Family Glycosyl-asparaginase 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|79313
Sequence length 430
Sequence
MYIMPLYLVVSSPNVILILWYTVVKCDSSFAVFGSKFRKLGPVAMFKEVWGSVDFFDSFV
YIFVISYCTLQVILMKTLPGKKFTGPVTSRNNVPLYYDNGFKCYVVTMFIYTAISIFLYK
FTKYRVTIFYDHFGNFLGIMTCVSLVLCLFLYWKGLKYPSSSDSGTTGNFLFDYYWGTEL
YPRIFEIDVKVFTNCRFGMTMWSLLVVTFALKNYELYGFVDSVWLSTALQTIYFVKFFWW
ESGYLSTIDIMMDRAGFYICWGCLAYISGLYASLSLHLATHRVILGWTLTSLIFAIGLTS
IGVNYWADYQKQEVRRTNGACLIWGKKADVIRAYYELEDENKTVKTSLLLVSGFWGISRH
FHYLPELLLALCWSVPAGFQRAMPYSYLFFLTILLVHRTFRDDTKCRKKYKVYWEQYCNK
VPYKMIPGIF
Download sequence
Identical sequences T1G3M5
XP_009017740.1.102002 jgi|Helro1|79313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]