SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|79315 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|79315
Domain Number 1 Region: 6-166
Classification Level Classification E-value
Superfamily vWA-like 7.7e-29
Family Integrin A (or I) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|79315
Sequence length 382
Sequence
MIKNSVDSSDYMRNGDFLPTRLHAQQDAVNLVCHSKTRSNPENNVGLITLSRNTEVLVTL
TSDVAKLLAKLHQLRPKGDINFVSGIRVAHLVLKHRQGKNHKMRIIAFIGSPIEDSEKEL
VKLGKKLRKEKVNVDVINFGEESYNTEKLTAFINAINGSDGSGSHLVTVPSGPLLSDALL
SSPVIVGEDGAGGISSGYEFGVDPNEDPELALALRVSMEEQRAHQEEEARRAARNAARTV
VSTIQEEASDELLLKQALEMSMQNNAEKQENVPTTSKSISDMTEDEQMAFALKMSMEGAT
KLFHQQLSHIFVDLEKAFDREETKMEEDDMTEVLNDTDFLRSVLEGLPGVDPQSEAVKEA
VSQLSKNNEEPEKKNSKKKDDK
Download sequence
Identical sequences T1G3M6
XP_009017644.1.102002 jgi|Helro1|79315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]