SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|80450 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|80450
Domain Number 1 Region: 318-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 2 Region: 241-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 3 Region: 381-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|80450
Sequence length 430
Sequence
MCFSLCVFLRCQPAFEDATFGRTFRASSQCGQAPSMNCVDCECDAANKKLCFICDKNQIN
RTHPVTYLNDVESSSGPTCWVSKLRDRKVNLTLSLDKRYEFTYVTVEFCRGSQIPDPLIV
WKSFDFGRTWDVLKYFSKDCSAFQSGGLFEKFISQSDKKSIGKPEKWNRKQSSDNFNTNR
QKTLQEKNARKVGTHTCTNTHTHARTHIHAHKQTKLCQSDLGKLNETHFFAISNVVLGAR
CKCNGHASECAPKEEILNQEGGGLVRDHQTFSENSKKRLRCKCRHNTRGPDCNECKSLYN
DRPWARGTTKNPNECLACNCNQHTNHCRFNAKLFKLSKNQSGGVCVRCRHNTIGRYCHIC
SDGYYRNPDEPLDSARACIPCNCNPIGSHSHVCNRTSGQCECKKGVEGQTCNTCASGFQQ
GSSPSRPCVG
Download sequence
Identical sequences T1G408
jgi|Helro1|80450 XP_009018426.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]