SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|80670 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|80670
Domain Number 1 Region: 200-408
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 407-601
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-35
Family Laminin G-like module 0.00087
Further Details:      
 
Domain Number 3 Region: 7-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-30
Family Laminin G-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|80670
Sequence length 623
Sequence
DSPFRFPKFFGDGYLTLPFTRNGYKEFSVLVEFRPEQISGVLLFGHANNSHISDFFALLL
RDSHLVFRFDCGSGIGEIISHEPIKLMQWNYVLIRRHKWHASMVINNSSVTSGKSKGNFT
HINFCKNVYLGGLSTPNESLVGTSLNFQGCVKGLSLNGQPVDLRTKMFAGHALESKNIGD
CSSQVCRMIKCVNGGSCYENDIDKFVCLCPLGTNGVFCEKKIRLNTPRFTSLSYLQFIGL
QRNVLSYTEIDLLFQPFNETGLILYNGYSKTGIGDYISIFMLDGYVVYSFDLGTGSLTLK
SKEKVELGRWHVVWAVRTGREGFLKVDDQQMLEGVTSGAFTQLTLTLDLYIGGHRNFDEI
TQKIQARKSFEGCIQKLSINKRQMKLIEEAKTGINVKNCEHMCDKHPCLNGGKCVPDKDN
YECSCLLGYSGTNCNHNLIDQLKNPYFTGKSYLLFMDPDITQLTSGDRMNLTITFRTVSE
AGMLLWISNDDVSEYSDFLAIGIKNGHLFVTFNLGSGEITMFNNHSKVNDGSKHTLTLQR
YQKSASMNVDFMYLVKGYSEGPMTQLTTHGSLYIGGMDDITFKTFYKFHSGFIGCISDLS
FLPTRRVNLIAEADEGFNIKECD
Download sequence
Identical sequences T1G437
jgi|Helro1|80670 XP_009018745.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]