SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|80798 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|80798
Domain Number 1 Region: 234-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 195-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000767
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 40-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 153-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000469
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 116-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000036
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 82-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|80798
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000431
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|80798
Sequence length 296
Sequence
DYCRKAQCGNHGNCTNTRVGHKCNCQGLYTGINCRFINQSDHCLSNPCKNDGECSLNYWS
YTCRCKPPYSGSNCQDYCEEVKPCKNGAVCINSVRTGYECLCGEGLAGKNCELITGPCDV
SRCENGGMCSMNAEQHICTCPDSFYGDRCQFRSQCTSNPCKNFGRCVDERDGSYTCICSD
IYEGELCEFHSELADSCSSYPCKNGGTCLVVDDENFRCICRPPFYGVHCSIKSVEVNPCA
SDPCQNGGECVSSIDRKTFACQCSRNYLGQYCELRSVCWCVCVLVCCVCVCVCVCV
Download sequence
Identical sequences T1G456
XP_009018924.1.102002 jgi|Helro1|80798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]