SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|81791 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|81791
Domain Number 1 Region: 68-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000683
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|81791
Domain Number - Region: 37-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000342
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 158-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000807
Family Integrin beta EGF-like domains 0.09
Further Details:      
 
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00404
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 97-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00621
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 129-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family Integrin beta EGF-like domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|81791
Sequence length 298
Sequence
DCGHNCSNKGDCVGGRCRCQYGFAGRYCQEAACVKECNGRGLHASGHCICNDGWMGSDCG
LQVNTKNQILCRNGGVCYDGRCLCPVGFAGESCSVEVCDPPCVNGYCKDRKCVCFDGYAG
MNCSIRRCDTRCSGIRGTCHDGVCICGAGWYGTHCSMDGCPNACSSRGKCEMISLPPPPS
YSTSCRCDNGWSGSSCNVPVEYQCDDKIDNDQDTLVDCNDPDCCSVSKCMNTILCKSATE
PHNQLRRNEASCSTEAFYERVKFLVDAQNVQLSAHKDVFNDSLVVLLVFVWLVGWLVG
Download sequence
Identical sequences T1G4I8
jgi|Helro1|81791 XP_009020632.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]