SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|81865 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|81865
Domain Number 1 Region: 344-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000042
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 2 Region: 148-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000647
Family EGF-type module 0.023
Further Details:      
 
Domain Number 3 Region: 51-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000876
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 4 Region: 92-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000015
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 12-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 6 Region: 229-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000021
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 421-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000056
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 308-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 268-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000107
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 382-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 185-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|81865
Domain Number - Region: 457-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family Follistatin (FS) module N-terminal domain, FS-N 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|81865
Sequence length 498
Sequence
AGFTGFQCNERIDKCYSQPCKNGGTCSMQQSGSFQCQCSFPFSGTTCELSTDACLPNPCL
HYGTCIRDSNATPSRYRCICNAGFIGERCQGDVYACLSNPCQNGATCVEWTNGTNGYSCT
CTPNYSGNLCNVPYSNNTAPRTTPLPVLSCLSFPCTNGGTCFPINNIAYSCTCPTGWSGL
RCEANINECLPNNPCNNNFECTDTPGSFECKCLNGWSGKTFRVGCVSDDVCSSNPCGNTS
ICNDEWDSFTCTCKNGWIGTNCNTLSTNCSSHMCTNQASCIEKADKSGYTCQCPFGYAGN
YCELVAVSCNSSPCQNFGSCQVLQNGSYACNCLIGWTGSMCEVNIQECASNPCYVGSSCI
DQIGSYQCECVPGRSGVNCEIVNACSSYPCLNNGLCTEVSPSLFSCQCMQYYSGLRCEIA
SPCMNNPCQNGGTCTDNNGRAQCKCLSPFEGDTCMSVSPCSQNFCLNGGICDLESQDGKT
NYRLVMCNLLVQICFNRA
Download sequence
Identical sequences T1G4J8
XP_009020669.1.102002 jgi|Helro1|81865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]